hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbj/mbj00321/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1716 ( 277 res) mbj00321 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 38.6 8.5e-07 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/2 144 173 .. 1 30 [] 25.6 0.0071 ANK 2/2 177 206 .. 1 30 [] 13.0 42 Alignments of top-scoring domains: ANK: domain 1 of 2, from 144 to 173: score 25.6, E = 0.0071 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+TpL A+ g+l v+++Ll++gad+n mKIAA1716 144 EGKTPLVQAVLGGSLIVCEFLLQNGADVNQ 173 ANK: domain 2 of 2, from 177 to 206: score 13.0, E = 42 *->dGrTpLHlAaengnlevvklLldkgadina<-* Gr pLH+A g+ v l+l++gad +a mKIAA1716 177 LGRAPLHHATLLGRTGQVCLFLKRGADQHA 206 //