hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbj/mbj00321/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1716 ( 277 res) mbj00321 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Ank Ankyrin repeat 56.7 5.1e-13 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Ank 1/2 144 176 .. 1 33 [] 35.8 9.7e-07 Ank 2/2 177 209 .. 1 33 [] 20.9 0.031 Alignments of top-scoring domains: Ank: domain 1 of 2, from 144 to 176: score 35.8, E = 9.7e-07 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G TPL A+l g+l v+++Ll++GAd+n +d mKIAA1716 144 EGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDS 176 Ank: domain 2 of 2, from 177 to 209: score 20.9, E = 0.031 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G+ PLH+A l g++ v l+l++GAd +a d mKIAA1716 177 LGRAPLHHATLLGRTGQVCLFLKRGADQHALDQ 209 //