hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mid/mid07054/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1699 ( 977 res) mid07054 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Sec8_exocyst Sec8 exocyst complex component specific 263.8 2.3e-75 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Sec8_exocyst 1/1 3 146 .. 1 170 [] 263.8 2.3e-75 Alignments of top-scoring domains: Sec8_exocyst: domain 1 of 1, from 3 to 146: score 263.8, E = 2.3e-75 *->mnApppesasRgrkigkdenlsnnaErieGllinvIrrdyqamVEtD m+A+++++++R++++++++++ Glli+vIr mKIAA1699 3 MAAEAAGGKYRSTVSKSKDPS--------GLLISVIR---------- 31 CiPleLsLalsddtdvGrehEykrfeqlykridasLqelVheHkqdftts +L++sdd+++ re+E++r+e++y+++d++L+el+++H++++tt+ mKIAA1699 32 ------TLSTSDDVED-RENEKGRLEEAYEKCDRDLDELIVQHYTELTTA 74 iasygkisssIqnsrerIhalKesLkasKelLettrSdELkkLwaeslqy i++y++i+++I+nsr++I+++Ke+L+++K+lL+++r dEL+kLw+e++++ mKIAA1699 75 IRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKR-DELRKLWIEGIEH 123 kkVlevLkeleELrqvPdkleel<-* k+Vl++L+e+e+++qvP+kle++ mKIAA1699 124 KHVLNLLDEIENIKQVPQKLEQC 146 //