hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mie/mie39080/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1665 ( 115 res) mie39080 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RNA_pol_Rbc25 RNA polymerase III subunit Rpc25 208.2 1.2e-58 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RNA_pol_Rbc25 1/1 1 112 [. 1 143 [] 208.2 1.2e-58 Alignments of top-scoring domains: RNA_pol_Rbc25: domain 1 of 1, from 1 to 112: score 208.2, E = 1.2e-58 *->PFvGEVltGkIkgCSrEGihVslLgFFDDIfIPkemLfepsvFeeeE kgCS EG+hVs LgFFDDI+IP+e+L++p++F+e+E mKIAA1665 1 -----------KGCSPEGVHVS-LGFFDDILIPPESLQQPAKFDEAE 35 qaWvWeydeEDGeepteLYlDvgEeIRFRVeeevFvDisPkspkeakele q+WvWey++E+G+ ++LY+D+gEeIRFRV +e FvD+sP +p+ a++++ mKIAA1665 36 QVWVWEYETEEGA--HDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAAS 83 eagdlyslreakesqaeeedeakekkpPYaLigScqedGLGlvSWW<-* + ++e+ k++PY+L+gS++e+GLGl+SWW mKIAA1665 84 S-----------------SEELPKKEAPYTLVGSISEPGLGLLSWW 112 //