hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg18106/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1650 ( 856 res) mbg18106 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SAM_1 SAM domain (Sterile alpha motif) 89.3 7.6e-23 1 SAM_2 SAM domain (Sterile alpha motif) 57.2 3.6e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SAM_1 1/1 791 854 .. 1 66 [] 89.3 7.6e-23 SAM_2 1/1 790 856 .] 1 72 [] 57.2 3.6e-13 Alignments of top-scoring domains: SAM_1: domain 1 of 1, from 791 to 854: score 89.3, E = 7.6e-23 *->dgwsvesVgeWLesigllgqYidnFlaagyidgdtllqlteeDLedl + ws ++Vg+WLesi+l g+++d F + ++i g +l lt+eD+++l mKIAA1650 791 QLWSKFDVGDWLESIHL-GEHRDRF-EDHEIEGAHLPALTKEDFVEL 835 GvtllGHrkkIlssIqgLk<-* Gvt++GHr+ I +++++L mKIAA1650 836 GVTRVGHRMNIERALRQLD 854 SAM_2: domain 1 of 1, from 790 to 856: score 57.2, E = 3.6e-13 *->veswslesvaeWLesiglegqYkdnFsdqgitglellllrlteedLa ws +v++WLesi+l g+++d F+d++i+g +l + lt ed mKIAA1650 790 LQLWSKFDVGDWLESIHL-GEHRDRFEDHEIEG-AHL-PALTKEDF- 832 klalGitsvghRkkilskiqelkqq<-* +lG+t vghR i +++ +l ++ mKIAA1650 833 V-ELGVTRVGHRMNIERALRQLDGS 856 //