hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph01246/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1646 ( 409 res) mph01246 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DAGK_cat Diacylglycerol kinase catalytic domain (pres 102.4 9e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DAGK_cat 1/1 10 155 .. 1 152 [] 102.4 9e-27 Alignments of top-scoring domains: DAGK_cat: domain 1 of 1, from 10 to 155: score 102.4, E = 9e-27 *->kllvivNPksGggkgkkelayerkvleklrkalneaqvfeteeqtgg +llv++NP++G+g+gk++ ++ +v +++ +a ++++++ te++++ mKIAA1646 10 HLLVFINPFGGKGQGKRIYEK--TVAPLFTLASITTEIIITEHANQA 54 pahalelaralgdfkydvDlvvvaGGDGTvneVvngLagrddrakai... ++ +e+ + + + D++v++GGDG+++eV+ g+ gr +++ i+++ mKIAA1646 55 KETLYEI--NTDSY----DGIVCVGGDGMFSEVLHGVIGRTQQSAGIdpn 98 ..R...ifprpplGiiPlGTgNdfAraLgipldpegAkaalaallailgq ++R + +++ +GiiP+G++ ++ ++d e+ +al++i+g+ mKIAA1646 99 hpRavlVPSTLRIGIIPAGSTDCVCYSTVGTNDAET-----SALHIIIGD 143 ilcradvvvldrw<-* l ++dv+ + + mKIAA1646 144 SL-AIDVSSVHYH 155 //