hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm08021/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1633 ( 1855 res) mpm08021 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Spindle_assoc Spindle associated 132.5 7.8e-36 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Spindle_assoc 1/1 102 164 .. 1 63 [] 132.5 7.8e-36 Alignments of top-scoring domains: Spindle_assoc: domain 1 of 1, from 102 to 164: score 132.5, E = 7.8e-36 *->LkKENFgLKLkIyFLeErLnkkseegiediiKeNiELKvevesLqRd LkKENF+LKL+IyFLeEr+++++++++e+i+K+NiELKvevesL+R+ mKIAA1633 102 LKKENFNLKLRIYFLEERIQQEFAGPTEHIYKTNIELKVEVESLKRE 148 lqgykkklsklekqle<-* lq+++++l+k++k++e mKIAA1633 149 LQEKDQLLVKASKAVE 164 //