hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh04778/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1625 ( 222 res) mbh04778 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HECT HECT-domain (ubiquitin-transferase) 301.6 9.7e-87 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HECT 1/1 1 220 [. 1 366 [] 301.6 9.7e-87 Alignments of top-scoring domains: HECT: domain 1 of 1, from 1 to 220: score 301.6, E = 9.7e-87 *->tLlsrelfnPdygLFeysdnseakseeddsysgyvedsytlfpnPls P+s mKIAA1625 1 --------------------------------------------PDS 3 gesnpehervlkyFkflGrilGlAlydgrllDlpFsraFyKklLmagkps ++ np+h l+yF+f+Gri+GlA+++g++++ F+ +FyK+lL gkp mKIAA1625 4 SI-NPDH---LSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLL--GKP- 46 igivtleDlesvDPelynSLkwllendgdKkIedsLLgsledveedLeLt + l+DlesvDPel++SL+w+lend++ +L+ t mKIAA1625 47 ---IQLSDLESVDPELHKSLVWILENDIT---------------PVLDHT 78 FsveeessvgfeadarffGgtktveELkPnGrnipVTneNkeeYvelyvd F+ve++ f G + ++e LkPnGrn+pVT+eNk+eYv+lyv+ mKIAA1625 79 FCVEHNA---F-------GRILQHE-LKPNGRNVPVTEENKKEYVRLYVN 117 yrLnkgiekQfeAFrkGFsevipsrlLslFdpeELelLicGspeeiDvdd +r+ +gie Qf A++kGF+e+ip +lL+ Fd +ELel+i+G++ +iD++d mKIAA1625 118 WRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLD-KIDLND 166 LkenTeYdggYtedsplktiqwFWevleeftneeraklLqFvTGssRlPv +k+nT+ + ++ +ds +++wFW+++e f++e ra+lLqFvTGs R+P+ mKIAA1625 167 WKSNTRLK-HCVADSN--IVRWFWQAVETFDEERRARLLQFVTGSTRVPL 213 gGFkaLqgGsnGpPkFtIvrkegggdddrLPtAhTCFNrLkLPpYsSkei +GFkaLq mKIAA1625 214 QGFKALQ------------------------------------------- 220 LrekLllAInEgseGFgle<-* mKIAA1625 - ------------------- - //