hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg08078/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1621 ( 810 res) mbg08078 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Cadherin Cadherin domain 281.2 1.3e-80 5 Cadherin_2 Cadherin-like 177.6 2e-49 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Cadherin_2 1/1 40 123 .. 1 84 [] 177.6 2e-49 Cadherin 1/5 149 244 .. 1 107 [] 27.6 0.00029 Cadherin 2/5 258 349 .. 1 107 [] 86.7 4.8e-22 Cadherin 3/5 363 453 .. 1 107 [] 53.6 4.4e-12 Cadherin 4/5 467 563 .. 1 107 [] 73.9 3.3e-18 Cadherin 5/5 579 674 .. 1 107 [] 44.4 2.5e-09 Alignments of top-scoring domains: Cadherin_2: domain 1 of 1, from 40 to 123: score 177.6, E = 2e-49 *->gqirYSVpEEterGsfVGNlAKDLGLdvqeLaaRgaRivSggnkqyF + YS+ EEterGsfV+Nl KDLG d++e+++R+aRi+S+ nk+++ mKIAA1621 40 ELGPYSIEEETERGSFVANLGKDLGVDLAEISNRRARIISQENKEHL 86 qlnletGdLlvnERiDREeLCgqsepCvLhlevllEn<-* qlnl++GdLl+nE++DREeLCg++epCvLh++vl+En mKIAA1621 87 QLNLQSGDLLINEKLDREELCGSIEPCVLHFQVLMEN 123 Cadherin: domain 1 of 5, from 149 to 244: score 27.6, E = 0.00029 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr ++ En++ G + +A D+D + N +Y++++++ +F mKIAA1621 149 MILRILENSALGDTFPLNNALDSD--VAINNIQTYRLSSNS---HFL 190 IdpdtGdnegi...isttkpLDREeifngeYeLtveAtDadpllasgggp + +++ ++ + +++ + k+LDREe +e +Lt+ A D+ g p mKIAA1621 191 VVTRNRSDGRKypeLVLEKELDREEE--PELRLTLTALDG-------GAP 231 plsstatvtitVl<-* p+s+ta+v i+V mKIAA1621 232 PRSGTAQVLIEVV 244 Cadherin: domain 2 of 5, from 258 to 349: score 86.7, E = 4.8e-22 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnp..ggw y +++pEn+p+G+ vltv A D D +g+ g++ Y++++++++ +++ mKIAA1621 258 YRVQIPENSPTGSLVLTVSANDLD--SGDYGKVLYALSQPSEdiSKT 302 FrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggpp +++p tG+ i+++k++D E+i + Ye+ ++AtD++ + mKIAA1621 303 LEVNPVTGE----IRLRKEVDFETI--PSYEVDIKATDGG---------G 337 lsstatvtitVl<-* ls+ +t+ +V mKIAA1621 338 LSGKCTLLLKVV 349 Cadherin: domain 3 of 5, from 363 to 453: score 53.6, E = 4.4e-12 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr + vpEn+p v+++ + D+D ++ Ng+ si ++ p F mKIAA1621 363 LTSPVPENSP-DEVVAVFSVKDPD--SANNGKMIASIEEDLP---FL 403 IdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggppls + + +G n ++ t++ LDREe+ ++Y++t+ ++D g+p l+ mKIAA1621 404 LKS-SGKNFYTLVTKRALDREER--EKYNITITVSDL-------GTPRLT 443 statvtitVl<-* + t+t++V mKIAA1621 444 TQHTITVQVS 453 Cadherin: domain 4 of 5, from 467 to 563: score 73.9, E = 3.3e-18 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnp..... y+ v+En ++ +++t+ AtD+D g N+ i+Ys+l+ + ++ mKIAA1621 467 YTLFVRENNSPAMHIGTISATDSD--AGSNSHISYSLLPSHDpqlal 511 ggwFrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgg + +I+ d+G+ ++ + LD+E+ + +e++v A D+ g mKIAA1621 512 DSLISINADNGQ----LFALRALDYEAL--QAFEFHVGAIDQ-------G 548 gpplsstatvtitVl<-* +p+lss a v++ Vl mKIAA1621 549 SPALSSQALVRVVVL 563 Cadherin: domain 5 of 5, from 579 to 674: score 44.4, E = 2.5e-09 *->ysasvpEnap....vGtevltvtAtDaDdPlgpNgrirYsilggnpg sa + E p+ ++G v+ v A+D+D +g+N+ +++ +l+ ++ mKIAA1621 579 SSAPCTELLPraaePGYLVTKVVAVDRD--SGQNAWLSFQLLKATEP 623 gwFrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasggg g F++ ++G+ ++tt+ L ++++L+++++D+ g mKIAA1621 624 GLFSVWAHNGE----VRTTRLLSERDV--PKHRLVLLVKDN-------GD 660 pplsstatvtitVl<-* pp+s+ +t+++ V mKIAA1621 661 PPRSASVTLHVLVV 674 //