hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj44318/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1620 ( 1418 res) mfj44318 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PDZ PDZ domain (Also known as DHR or GLGF) 13.3 0.082 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PDZ 1/1 45 124 .. 1 82 [] 13.3 0.082 Alignments of top-scoring domains: PDZ: domain 1 of 1, from 45 to 124: score 13.3, E = 0.082 *->evtlekevkrgglGfsikggsdkgivvsevlpGsgaAeagGrLkeGD e+++e e + g Gf+++gg+++gi+v e+ ++s+aA+ L+eGD mKIAA1620 45 EIIVETEAQTGVSGFNVAGGGKEGIFVRELREDSPAAKSLS-LQEGD 90 qIlsvNGqdvenlsheravlalkgsggsevtLtil<-* q+ls + +en+ e+a +l+ + +v+ ++ mKIAA1620 91 QLLSA-RVFFENFKYEDALRLLQCAEPYKVSFCLK 124 //