hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph00170/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1523 ( 884 res) mph00170 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PHD PHD-finger 34.1 3.2e-06 1 C1_1 Phorbol esters/diacylglycerol binding domain -0.1 0.28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- C1_1 1/1 144 190 .. 1 55 [] -0.1 0.28 PHD 1/1 154 202 .. 1 51 [] 34.1 3.2e-06 Alignments of top-scoring domains: C1_1: domain 1 of 1, from 144 to 190: score -0.1, E = 0.28 *->HhFvhrwnfkqptfCdhCgellwgslgkqGlkCswCklnvHkrChek H+ + + C C+ ++ + +C+ C l++H +C e mKIAA1523 144 HNGLVP---LPVKVCFTCNRSC---RVAPLIQCDYCPLLFHMDCLE- 183 VppeCgcg<-* pp+ + mKIAA1523 184 -PPLTAMP 190 PHD: domain 1 of 1, from 154 to 202: score 34.1, E = 3.2e-06 *->yCsvCgkpdddaggdllqCDgCdrwfHlaClgppleeppegkWlCpe C+ C++ l+qCD C+ fH++Cl ppl+++p g W Cp+ mKIAA1523 154 VCFTCNRSCR--VAPLIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPN 198 Ctpk<-* +++ mKIAA1523 199 HIEH 202 //