hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm11207/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1521 ( 1446 res) mpm11207 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- VPS9 Domain present in VPS9 96.7 2.6e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- VPS9 1/1 1341 1446 .] 1 120 [] 96.7 2.6e-24 Alignments of top-scoring domains: VPS9: domain 1 of 1, from 1341 to 1446: score 96.7, E = 2.6e-24 *->FveieqielkflqlskmYSPsdKikcLLrackviytlletqsKgeva +++++q e + +k +P+dK+ c+Lr c i +ll + v mKIAA1521 1341 PWPSAQSEIRTISAYK--TPRDKVQCILRMCSTIMNLLSLANEDSVP 1385 GADdFlPvLiYvIikcdprdLllnveYieeflepslltGeegYYLtsLeA GADdF PvL++v+ik++p+ Ll+ v+Yi+ f + s l+Gee+Y + + A mKIAA1521 1386 GADDFVPVLVFVLIKANPPCLLSTVQYISSF-YASCLSGEESYWWMQFTA 1434 ALafikgLteadalilspedeee<-* A++fik++ d ++ mKIAA1521 1435 AVEFIKTI-----------DDRK 1446 //