hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh00594/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1520  ( 782 res)   mbh00594

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
AAA      ATPases associated with a variety of cellula    70.7    1.8e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
AAA        1/1     547   733 ..     1    92 []    70.7  1.8e-16

Alignments of top-scoring domains:
AAA: domain 1 of 1, from 547 to 733: score 70.7, E = 1.8e-16
                   *->pgevvllvGppGsGKTTlaralarllgp..gviyidge.........
                      pg+v++lvGp+GsGK+  ++ l ++++ ++g +++dg   +  +++ 
   mKIAA1520   547    PGKVTALVGPSGSGKSSCVNILENFYPLqgGRVLLDGKpigaydhky 593  

                   ..................................................
                    ++  +  +++     ++  ++ + +      +   +  ++ + ++   +
   mKIAA1520   594 lhrvislvsqepvlfarsitdnisyglptvpfemvveaaqkanahgfime 643  

                   .................ggqrirlalalark...dvlllDEitslld...
                    +++ + + ++++ + +ggq++r+a+a+a  ++++vl+lDE+ts+ld ++
   mKIAA1520   644 lqdgystetgekgaqlsGGQKQRVAMARALVrnpPVLILDEATSALDaes 693  

                   ..............vtviattndldpallrrrfdrrivllril<-*
                   + + ++  ++++++ tv+++++   ++ ++ r+  ++vl++++   
   mKIAA1520   694 eyliqqaihgnlqrHTVLIIAH---RLSTVERAHLIVVLDKGR    733  

//