hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph00522/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1478 ( 644 res) mph00522 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 215.2 9.8e-61 1 C1_1 Phorbol esters/diacylglycerol binding domain 36.4 6.5e-07 1 C1_3 C1-like domain 8.4 0.35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- C1_3 1/1 315 345 .. 1 30 [] 8.4 0.35 C1_1 1/1 304 355 .. 1 55 [] 36.4 6.5e-07 RhoGAP 1/1 380 530 .. 1 155 [] 215.2 9.8e-61 Alignments of top-scoring domains: C1_3: domain 1 of 1, from 315 to 345: score 8.4, E = 0.35 *->ktCdaCglpidg.dpfYsCseCdFvlHeeCa<-* C Cg+ i+++ + +C C v H eC mKIAA1478 315 ESCVPCGKRIKFgKLSLKCRDCRLVSHPECR 345 C1_1: domain 1 of 1, from 304 to 355: score 36.4, E = 6.5e-07 *->HhFvhrwnfkqptfCdhCgellwgslgkqGlkCswCklnvHkrChek H+Fv + + +p +C Cg+++ ++gk lkC++C l+ H +C + mKIAA1478 304 HDFVSK-TVIKPESCVPCGKRI--KFGKLSLKCRDCRLVSHPECRDR 347 VppeCgcg<-* p C++ mKIAA1478 348 CPLPCIPP 355 RhoGAP: domain 1 of 1, from 380 to 530: score 215.2, E = 9.8e-61 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P+iv++C++++e+rGL++ G+yR+sG+ ++keL+e+f + + v l mKIAA1478 380 PAIVVSCVNEIEQRGLTEAGLYRISGCDRTVKELKEKFLKVKTVPL- 425 dleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerlea + + d+hv++slLK+FLR+L ePLltf l ++f+e aa++ de++ a mKIAA1478 426 LSKVDDIHVICSLLKDFLRNLKEPLLTFWLSKAFME-AAEITDEDNSTAA 474 lrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLlr +++++++LP+aNrdtL++L+ hL+rV+q+ + +kM++ NLA vFgPt++ mKIAA1478 475 MYQAVSELPQANRDTLAFLMIHLQRVSQSPD-TKMDIANLAKVFGPTIVA 523 ppdgdsad<-* + + ++d mKIAA1478 524 HTVP-NPD 530 //