hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mfj/mfj00439/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1465 ( 785 res) mfj00439 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- LRR_TYP Leucine-rich repeats, typical (most populate 58.1 1.1e-12 4 LRRCT Leucine rich repeat C-terminal domain 55.7 6e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LRR_TYP 1/4 89 113 .. 1 24 [] 13.4 9.7 LRR_TYP 2/4 138 161 .. 1 24 [] 10.5 22 LRR_TYP 3/4 162 185 .. 1 24 [] 19.9 0.36 LRR_TYP 4/4 186 209 .. 1 24 [] 27.5 0.0019 LRRCT 1/1 221 271 .. 1 55 [] 55.7 6e-12 Alignments of top-scoring domains: LRR_TYP: domain 1 of 4, from 89 to 113: score 13.4, E = 9.7 *->LpnL.reLdLsnNqLtsLPpgaFqg<-* Lp+ ++L+Ls N++t L +gaF + mKIAA1465 89 LPANvTTLSLSANKITVLRRGAFVN 113 LRR_TYP: domain 2 of 4, from 138 to 161: score 10.5, E = 22 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L+ LdLs+N ++ P +++ mKIAA1465 138 LSQLKNLDLSHNLISNFPWSDLRN 161 LRR_TYP: domain 3 of 4, from 162 to 185: score 19.9, E = 0.36 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L+ L ++N+L sLP++a++ mKIAA1465 162 LSALQLLKMNHNRLGSLPRDALGA 185 LRR_TYP: domain 4 of 4, from 186 to 209: score 27.5, E = 0.0019 *->LpnLreLdLsnNqLtsLPpgaFqg<-* Lp Lr+L+ +nN+L++L pg+F+ mKIAA1465 186 LPDLRSLRINNNRLRTLEPGTFDA 209 LRRCT: domain 1 of 1, from 221 to 271: score 55.7, E = 6e-12 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll NPf+C+C+L wL+ w +++ l++p+ s+ CasP++l+G p+ +l mKIAA1465 221 NPFHCSCGLVWLQAWAAS-TRVSLPEPD-SIACASPPELQGVPVHRL 265 lpsefsCp<-* + +C mKIAA1465 266 P--ALPCA 271 //