hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg01572/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1461  ( 1753 res)   mbg01572

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
MBD      Methyl-CpG binding domain                       28.1    0.00015   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
MBD        1/1      41   113 ..     1    87 []    28.1  0.00015

Alignments of top-scoring domains:
MBD: domain 1 of 1, from 41 to 113: score 28.1, E = 0.00015
                   *->edelrlPaLppGWrRetvqRksgKKssagkgDVyYisPcGkkLRsks
                       + + +P    GW R++            ++ V YisP+G  L+   
   mKIAA1461    41    LAAIQVP---VGWQRRVD-----------HNGVLYISPSGSLLSCLD 73   

                   ElarYLhkngdlslaledPLRPEYlFdFnarvpvgpkitp<-*
                   +++ YL + g+++++le+PL     F F+++  v     +   
   mKIAA1461    74 QVKTYLLTDGTCKCGLECPLILPKVFNFDPGAAVKQRTAE    113  

//