hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/TIGRFAMs_HMM.LIB Sequence file: /cdna4/rodent/full/goal/mbg/mbg00055/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1455 ( 1828 res) mbg00055 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- YD_repeat_2x YD_repeat_2x: YD repeat (two copies) 78.1 1.9e-19 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- YD_repeat_2x 1/6 676 717 .. 1 42 [] 14.5 2 YD_repeat_2x 2/6 740 781 .. 1 42 [] 25.7 0.0011 YD_repeat_2x 3/6 952 992 .. 1 42 [] 20.5 0.041 YD_repeat_2x 4/6 1261 1302 .. 1 42 [] 9.4 23 YD_repeat_2x 5/6 1336 1378 .. 1 42 [] 10.1 17 YD_repeat_2x 6/6 1404 1445 .. 1 42 [] 1.9 8.4e+02 Alignments of top-scoring domains: YD_repeat_2x: domain 1 of 6, from 676 to 717: score 14.5, E = 2 *->ydaagrllgstdpdgtttrytydaagrlveetdpdggstsle<-* y+++++++++td +g+t r d v++ +pd+++ l+ mKIAA1455 676 YSNDNDVTAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLT 717 YD_repeat_2x: domain 2 of 6, from 740 to 781: score 25.7, E = 0.0011 *->ydaagrllgstdpdgtttrytydaagrlveetdpdggstsle<-* +++ g l++ d+ g+tt ++yd++grl+ +t p g +t l+ mKIAA1455 740 HGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLH 781 YD_repeat_2x: domain 3 of 6, from 952 to 992: score 20.5, E = 0.041 *->ydaagrllgstdpdgtttrytydaagrlveetdpdggstsle<-* y+ g+++++ +++yd++gr+v++ +dg+++s++ mKIAA1455 952 YSSTGQIASIQRGTT-SEKVDYDSQGRIVSRVFADGKTWSYT 992 YD_repeat_2x: domain 4 of 6, from 1261 to 1302: score 9.4, E = 23 *->ydaagrllgstdpdgtttrytydaagrlveetdpdggstsle<-* yd +g+l ++ + +ry+yd g+l + + + mKIAA1455 1261 YDVDGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSSSARLTPL 1302 YD_repeat_2x: domain 5 of 6, from 1336 to 1378: score 10.1, E = 17 *->ydaagrllgstdpd.gtttrytydaagrlveetdpdggstsle<-* y+ g l+++ ++g+t+ y yd++gr+v+ + g+ ++ mKIAA1455 1336 YSSKGLLTRVYSKGsGWTVIYRYDGLGRRVSSKTSLGQHLQFF 1378 YD_repeat_2x: domain 6 of 6, from 1404 to 1445: score 1.9, E = 8.4e+02 *->ydaagrllgstdpdgtttrytydaagrlveetdpdggstsle<-* yd +g+l + +g + d g +++ + +g + mKIAA1455 1404 YDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQI 1445 //