hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpg/mpg01109/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1443 ( 564 res) mpg01109 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Homeobox Homeobox domain -0.2 0.0054 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Homeobox 1/1 375 429 .. 1 57 [] -0.2 0.0054 Alignments of top-scoring domains: Homeobox: domain 1 of 1, from 375 to 429: score -0.2, E = 0.0054 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW + kR t+eQl +L+ +F +++ re+ +L + +gL+ + W mKIAA1443 375 KTKR--KTKEQLAILKSFFLQCQWARREDYHKLEQITGLPRPEIIQW 419 FQNRRaKwKk<-* F R+ K mKIAA1443 420 FGDTRYALKH 429 //