hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm10268/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1417 ( 1167 res) mpm10268 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- BTB BTB/POZ domain 80.7 3.1e-20 2 Ank Ankyrin repeat 33.7 4.1e-06 1 RCC1 Regulator of chromosome condensation (RCC1) 28.2 0.00018 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Ank 1/1 1 33 [. 1 33 [] 33.7 4.1e-06 RCC1 1/2 62 114 .. 1 68 [] 24.1 0.0032 RCC1 2/2 118 170 .. 1 68 [] 4.0 1.7 BTB 1/2 370 484 .. 1 135 [] 37.4 3.2e-07 BTB 2/2 573 687 .. 1 135 [] 50.8 2.9e-11 Alignments of top-scoring domains: Ank: domain 1 of 1, from 1 to 33: score 33.7, E = 4.1e-06 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G+T+LH +++g++++v Ll++G +l +qd+ mKIAA1417 1 SGWTALHRSVFYGHIDCVWSLLKHGVSLYMQDK 33 RCC1: domain 1 of 2, from 62 to 114: score 24.1, E = 0.0032 *->dGrVYslGcFRgenGqLG.lgeeveeskGGRqGLERLlvPvlvmLKs dG VY++G+ + +qLG +++++++ vP ++ mKIAA1417 62 DGCVYTFGL--NMFHQLGiIPPPASCN-----------VPRQI---Q 92 rssslsekVvsvasGgqHtval<-* + + va+G Htv+ mKIAA1417 93 AKYLKGRTIIGVAAGRFHTVLW 114 RCC1: domain 2 of 2, from 118 to 170: score 4.0, E = 1.7 *->dGrVYslGcFRgenGqLGlg...eeveeskGGRqGLERLlvPvlvmL VY+lG+ + GqLG + ++ ++++ P +v mKIAA1417 118 --AVYTLGL---NGGQLGHLldpNGEKCVT----------TPRQV-- 147 KsrssslsekVvsvasGgqHtval<-* s + +V+ va+ + tv++ mKIAA1417 148 -SALHHKDIAVSLVAASDGATVCV 170 BTB: domain 1 of 2, from 370 to 484: score 37.4, E = 3.2e-07 *->lnelreqgelcDVtLvvgdgsgrydvgkkfkAHKavLaacSpYFkal l e e +++ DVt++vg+ ++f+AHK +La +S++F++l mKIAA1417 370 LRETDEMDSFHDVTFQVGN--------RHFPAHKYILAVRSDFFQKL 408 Ftgqfkesiteeessvs.......seieledvspedfealLefiYtgels F++++ + ++ + ++ +++ + e v p+ fe lL+f+Yt++ + mKIAA1417 409 FLSDGSS-LELTDVYQKdedaagcHLFVVEKVHPDLFEYLLQFMYTDTCD 457 itqdqksPssckseenvedlLalAad.llqipslvdkCeefliksl<-* + L ++ +++ +++ + Ce + +l mKIAA1417 458 L-------------------LTHGFKpRMIVKRKAEDCEGSPDSHL 484 BTB: domain 2 of 2, from 573 to 687: score 50.8, E = 2.9e-11 *->lnelreqg.elcDVtLvvgdgsgrydvgkkfkAHKavLaacSpYFka l+ + ++ ++l DVt + d gk+f +HK+vL+a+ +YF++ mKIAA1417 573 LKLSQKKCsFLYDVTMKSVD-------GKEFSCHKCVLCARLEYFHS 612 lFtgqfkesiteeessvsseieledvspedfealLefiYtgelsitqdqk +++ + +e ss +e +++e+++ +L+++Yt+e+ + mKIAA1417 613 MLSRSW-----IEASSCA-ALE-MPIQSEILKVILDYLYTDEAVVI---- 651 sPssckseenve...dlLalAadllqipslvdkCeefliksl<-* k+ +nv+ ++L A d l i +l+++Ce l ++l mKIAA1417 652 -----KESQNVDfvcSVLVVA-DQLLITRLKEICEVALTENL 687 //