hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg19945/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1391 ( 1063 res) mbg19945 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 196.9 3.2e-55 1 RA Ras association (RalGDS/AF-6) domain 68.8 1.1e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RA 1/1 75 164 .. 1 98 [] 68.8 1.1e-16 RhoGAP 1/1 258 408 .. 1 155 [] 196.9 3.2e-55 Alignments of top-scoring domains: RA: domain 1 of 1, from 75 to 164: score 68.8, E = 1.1e-16 *->dsgvlrVygedgtpgt.yktilvskntTaeeViralLrKfgldaddp +s l+++ d+ ++ +kti v +++Ta+eVi++ L+++g+ + + mKIAA1391 75 KSIPLKIFAKDIGNCAyFKTITVMNSDTASEVINMSLQMLGI-TGSE 120 edyvLvEvslvlerggeerrvLpddEkPlqiqlqlkrdaqvrsrFlLrrr +dy+L++ ++++ + +L +E+P+ i + + r ++ +l ++ mKIAA1391 121 RDYQLWV---NSGKEAAPY-PLIGHEYPYGIKMSHLR----DTALLTQGS 162 ed<-* +d mKIAA1391 163 RD 164 RhoGAP: domain 1 of 1, from 258 to 408: score 196.9, E = 3.2e-55 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P+++ ++++fl ++G+ t+GI+R+s++ + ++eL+e++++g +v mKIAA1391 258 PKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEV--- 301 dleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerlea +l++e++ v+As+LK+FLR++Pe++++ +ly+++++ +++ ++ee+++ mKIAA1391 302 HLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVC-VMDQGNDEEKINI 350 lrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLlr +++ll++LP+aN LryL++ L+++ q+s N+Mta NLA++++P++l+ mKIAA1391 351 IQRLLDQLPRANVVFLRYLFGVLHNIEQHSLSNQMTAFNLAVCIAPSILW 400 ppdgdsad<-* pp++ s++ mKIAA1391 401 PPASSSPE 408 //