hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg07509/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1386 ( 1087 res) mbg07509 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 51.0 1.5e-10 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/2 47 77 .. 1 30 [] 18.1 1.3 ANK 2/2 147 176 .. 1 30 [] 33.0 4e-05 Alignments of top-scoring domains: ANK: domain 1 of 2, from 47 to 77: score 18.1, E = 1.3 *->dGrTpLHlAaengnlevvklLldkga.dina<-* + +TpLH+Aa++g ++ +l +++n+ mKIAA1386 47 QHNTPLHYAARHGMNRILGTFLFGRDgNPNK 77 ANK: domain 2 of 2, from 147 to 176: score 33.0, E = 4e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* +TpLH+Aa++g + +v+lL+++g+d+ a mKIAA1386 147 KKNTPLHYAAASGMKACVELLVKHGGDLFA 176 //