hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm05366/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1375 ( 909 res) mpm05366 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- BRO1 BRO1-like domain 307.9 1.2e-88 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- BRO1 1/1 43 207 .. 1 172 [] 307.9 1.2e-88 Alignments of top-scoring domains: BRO1: domain 1 of 1, from 43 to 207: score 307.9, E = 1.2e-88 *->efLsipLKkTsevDlvkpLtkyIsntYgsskcerpssyaedalqeLs f++++LKkTsevDl+kpL k+I++tY+s++ e++++y+ +a +eLs mKIAA1375 43 SFIWVQLKKTSEVDLAKPLVKFIQQTYPSGG-EEQAQYC-RAAEELS 87 kLRnqaisvgrpldkseagrldvllrYYqqLcaLenkFpssedqHigveF kLR+ a grpldk+e + l++llrYY+q+c++e+kFp+se+q i+++F mKIAA1375 88 KLRRSA--LGRPLDKHEGA-LETLLRYYDQICSIEPKFPFSENQ-ICLTF 133 tWyDafdkgslFgssvklsqssLaFEKAcVLFNigalySqiAasqinrtt tW+DafdkgslFg+svkl++ sL++EK+cVLFN++al+SqiAa+q n+++ mKIAA1375 134 TWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQ-NLDN 182 ddglKqAckyFQqAAGaFahlrdnf<-* d+glK+A+k +Q A+GaF h++d++ mKIAA1375 183 DEGLKTAAKQYQFASGAFLHIKDTV 207 //