hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph03038/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1314 ( 637 res) mph03038 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 180.0 3.8e-50 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 311 465 .. 1 155 [] 180.0 3.8e-50 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 311 to 465: score 180.0, E = 3.8e-50 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln Pl+++k + +e+ GL++EGI+R+sG+++++k+ re++d d++ mKIAA1314 311 PLVLQKFFQKVEESGLESEGIFRLSGCTAKVKQYREELDARFNADKF 357 dleeedvhvvAslLKlFLReLPePLltfelyeefi.eaaaksedeeerle ++ + +A +LK F+ReLP++L++ e++++fi++ + +d + + mKIAA1314 358 KWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFIsL-MERGPDIKVQFQ 406 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl al+++++ LP+aNrdt ++L+a++n+V++n+++N+M+ N+++v++P+L+ mKIAA1314 407 ALHLMVMALPDANRDTAQALMAFFNKVIANESKNRMNLWNISTVMAPNLF 456 rppdgdsad<-* +++++s++ mKIAA1314 457 FSRSKHSDC 465 //