hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg04314/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1306 ( 1347 res) mbg04314 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 155.4 5.7e-42 6 SAM Sterile alpha motif. 59.7 3.8e-13 1 SH3 Src homology 3 domains 32.4 6.1e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/6 35 64 .. 1 30 [] 30.9 0.00018 ANK 2/6 68 97 .. 1 30 [] 20.0 0.34 ANK 3/6 101 130 .. 1 30 [] 30.3 0.00027 ANK 4/6 134 163 .. 1 30 [] 17.4 2 ANK 5/6 175 204 .. 1 30 [] 42.8 4.7e-08 ANK 6/6 207 236 .. 1 30 [] 19.2 0.57 SH3 1/1 271 333 .. 1 58 [] 32.4 6.1e-05 SAM 1/1 458 525 .. 1 67 [] 59.7 3.8e-13 Alignments of top-scoring domains: ANK: domain 1 of 6, from 35 to 64: score 30.9, E = 0.00018 *->dGrTpLHlAaengnlevvklLldkgadina<-* dG+++LH+Aa ngn e++ lLl++ a +++ mKIAA1306 35 DGFSALHHAALNGNTELISLLLEAQAAVDI 64 ANK: domain 2 of 6, from 68 to 97: score 20.0, E = 0.34 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+ pLH+Aa g++e +kl l++g +n+ mKIAA1306 68 KGMRPLHYAAWQGRKEPMKLVLKAGSAVNV 97 ANK: domain 3 of 6, from 101 to 130: score 30.3, E = 0.00027 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+ pLHlAa++g+++v ++Ll++ ++ + mKIAA1306 101 EGHIPLHLAAQHGHYDVSEMLLQHQSNPCM 130 ANK: domain 4 of 6, from 134 to 163: score 17.4, E = 2 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+TpL lA+e g++ vv+lLl+++ + mKIAA1306 134 SGKTPLDLACEFGRVGVVQLLLSSNMCAAL 163 ANK: domain 5 of 6, from 175 to 204: score 42.8, E = 4.7e-08 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G +pLHlAa+ng++++++lLl++g din mKIAA1306 175 NGTSPLHLAAKNGHIDIIRLLLQAGIDINR 204 ANK: domain 6 of 6, from 207 to 236: score 19.2, E = 0.57 *->dGrTpLHlAaengnlevvklLldkgadina<-* T+LH Aa g evv+lLld+g + + mKIAA1306 207 KSGTALHEAALCGKTEVVRLLLDSGINAQV 236 SH3: domain 1 of 1, from 271 to 333: score 32.4, E = 6.1e-05 *->eyvvAlYDyea.qnedELsFkkGDiitvleksddgWweGelnr.... +v+A Dy + + L +k+GDiitvle++ dg w+G +++++++ mKIAA1306 271 LQVRATKDYCNnYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDnrtg 317 tGkeGlfPsnYVeeie<-* + ++G+fPs+ e i mKIAA1306 318 NDRVGYFPSSLGEAIV 333 SAM: domain 1 of 1, from 458 to 525: score 59.7, E = 3.8e-13 *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel + ++a WL igl+qY + + +ng+ +++ ++ edL+e+ mKIAA1306 458 SAsEGKANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEI 504 GitllGhRkkIlsaiqklkeq<-* Git+lGh+kk++ a++kl e mKIAA1306 505 GITKLGHQKKLMLAVRKLAEL 525 //