hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbh/mbh02561/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1274 ( 864 res) mbh02561 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PTPc_motif Protein tyrosine phosphatase, catalytic do 25.2 0.00051 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PTPc_motif 1/1 270 392 .. 1 92 [] 25.2 0.00051 Alignments of top-scoring domains: PTPc_motif: domain 1 of 1, from 270 to 392: score 25.2, E = 0.00051 *->tvkhyhytgWpDhvekdsgvPe....dsileflravrk......... ++yh + p++ g+P + + d++++ lr+ + + +++++ mKIAA1274 270 PTYRYHRLPLPEQ-----GAPLeaqfDAFVSVLRETPSllplrdnhg 311 ...PivVHCSAGvGRTGtfvaidillqq....................vd + + ++ C GvGRT +++ +l++ ++++++++ + ++ ++ ++ mKIAA1274 312 plpALLFSCQSGVGRTNLGMVLGTLVMFhhsrttsqleaasplakplpME 361 ifdtvkelRsqRpgmvqteeQYlFlyralle<-* f++++ + p+ ++ e+ + a++e mKIAA1274 362 QFQVIQGFICKVPQGKKMVEEVDRAISACAE 392 //