hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh02561/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1274  ( 864 res)   mbh02561

Scores for sequence family classification (score includes all domains):
Model      Description                                  Score    E-value  N 
--------   -----------                                  -----    ------- ---
PTPc_motif Protein tyrosine phosphatase, catalytic do    25.2    0.00051   1

Parsed for domains:
Model      Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------   ------- ----- -----    ----- -----      -----  -------
PTPc_motif   1/1     270   392 ..     1    92 []    25.2  0.00051

Alignments of top-scoring domains:
PTPc_motif: domain 1 of 1, from 270 to 392: score 25.2, E = 0.00051
                   *->tvkhyhytgWpDhvekdsgvPe....dsileflravrk.........
                        ++yh +  p++     g+P + + d++++ lr+  +  + +++++
   mKIAA1274   270    PTYRYHRLPLPEQ-----GAPLeaqfDAFVSVLRETPSllplrdnhg 311  

                   ...PivVHCSAGvGRTGtfvaidillqq....................vd
                   + + ++  C  GvGRT   +++ +l++ ++++++++ +  ++  ++ ++ 
   mKIAA1274   312 plpALLFSCQSGVGRTNLGMVLGTLVMFhhsrttsqleaasplakplpME 361  

                   ifdtvkelRsqRpgmvqteeQYlFlyralle<-*
                    f++++ +    p+  ++ e+    + a++e   
   mKIAA1274   362 QFQVIQGFICKVPQGKKMVEEVDRAISACAE    392  

//