hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/meh/meh00539/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1251 ( 1900 res) meh00539 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Spectrin Spectrin repeat 28.0 0.00023 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Spectrin 1/6 330 434 .. 1 108 [] 6.0 0.21 Spectrin 2/6 1072 1184 .. 1 108 [] -4.1 1.2 Spectrin 3/6 1197 1309 .. 1 108 [] 17.3 0.03 Spectrin 4/6 1465 1568 .. 1 108 [] 20.3 0.017 Spectrin 5/6 1582 1692 .. 1 108 [] 29.8 6.2e-05 Spectrin 6/6 1695 1801 .. 1 108 [] -4.2 1.3 Alignments of top-scoring domains: Spectrin: domain 1 of 6, from 330 to 434: score 6.0, E = 0.21 *->lllqqFqrdadelesWisekeallssedygkDlesvqaLlkkHeafe + l++F a ++ W++ ke++ d ++ ++ a+ + + ++ mKIAA1251 330 QSLHKFVSRATAELIWLNGKEEEELACDWSDSNPNISAKKTYFSELT 376 aelaahqqdrvdqlnelaqkLieegedhpdseeikerleeLnerWeaLle el++ q d ++ l+++a+ L e+ hp++ +++ +++ ++ +++++ mKIAA1251 377 MELEGKQ-DVFRFLQDTAEVLSLEN--HPAKQTVEAYSAAVQSQLQWMKQ 423 laaeRkqkLee<-* l+ +q + e mKIAA1251 424 LCLCVEQHVKE 434 Spectrin: domain 2 of 6, from 1072 to 1184: score -4.1, E = 1.2 *->lllqqFqrdadelesW...isekeallssedygkDlesvqaLlkkHe ++ q+ ++++l+ W +++ + + ++ +++++ + ++ mKIAA1251 1072 EEKQEHVEKVKDLLGWvstLARNTQGTTTSSHTSASADIEKAILEQQ 1118 afeaelaahqqdrvdqlnelaqkLieeged...hpdseeikerleeLner + +el + + ++v++ ++ q ++++++++ + ++e+i e+l Ln+ mKIAA1251 1119 VLAEELTTKK-EQVSEAIKTSQIFLAKHGHklsEGEKEQISEQLRVLNKT 1167 WeaLlelaaeRkqkLee<-* + +L++ a + q+L+ mKIAA1251 1168 YHDLCDGSANQLQQLQS 1184 Spectrin: domain 3 of 6, from 1197 to 1309: score 17.3, E = 0.03 *->lllqqFqrdadelesWisekeallssedygk...DlesvqaLlkkHe +++ ++++++l +W +++e+ l++ + g ++++l ++q+ + ++ mKIAA1251 1197 KQQDTCHKKLEDLCNWVGQAERALERHQGGAsrqELPALQQNQSDLK 1243 afeaelaahqqdrvdqlnelaqkLieeged...hpdseeikerleeLner +++ +++ h + + + + + ++ee++++ ++++ +++e+l + e+ mKIAA1251 1244 DLQGDIQSHS-TSFATAVKDIEGFLEENQTklsPQELTALREKLHQAKEQ 1292 WeaLlelaaeRkqkLee<-* +e L+e++ +++Lee mKIAA1251 1293 YEVLQERTRVAQKELEE 1309 Spectrin: domain 4 of 6, from 1465 to 1568: score 20.3, E = 0.017 *->lllqqFqrdadelesWisekeallssedygk.DlesvqaLlkkHeaf +lq+F +d +e+e+W+++ e++l s+ +g++++e++ +Llk++ f mKIAA1251 1465 DELQKFLQDHKEFENWLQQSENELDSMHKGGsSPEALNSLLKRQGSF 1511 eaelaahqqdrvdqlnelaqkLieeged...hpdseeikerleeLnerWe +++ h+ + ++ ++ +qk++e +++++ +++ ++e mKIAA1251 1512 SEDVISHK-GDLRFVTISGQKVLETENNfeeGQEPSATRNLVNE------ 1554 aLlelaaeRkqkLee<-* +L++++ eR L+ mKIAA1251 1555 KLKDAT-ERYTTLHS 1568 Spectrin: domain 5 of 6, from 1582 to 1692: score 29.8, E = 6.2e-05 *->lllqqFqrdadelesWisekea...llssedygkDlesvqaLlkkHe ++qqFq ad l++W ea+ + l s+ + D+ +q++l + mKIAA1251 1582 GQYQQFQSSADSLQAWVLTCEAsvgKLLSDTVASDPGVLQQQLATTK 1628 afeaelaahqqdrvdqlnelaqkLieeged.hpdseeikerleeLnerWe ++++ela hq v+ l++ a +L++ +++ d i+e+ + + +r++ mKIAA1251 1629 QLQEELAEHQ-VPVEKLQKAAHDLLDIEGEpALDCRPIQETTDSISSRFQ 1677 aLlelaaeRkqkLee<-* +L ++eR ++L+ mKIAA1251 1678 NLSCSLDERSALLQK 1692 Spectrin: domain 6 of 6, from 1695 to 1801: score -4.2, E = 1.3 *->lllqqFqrdadelesWisekeallssedygk.DlesvqaLlkkHeaf + q q ++ l++ i+e e+ l++++ + + +q l + mKIAA1251 1695 AQSQSVQESMESLLQSIREVEQNLERDQVASlSSGVIQEALANNMKL 1741 eaelaahqqdrvdqlnelaqkLieegedhpdseeikerleeLnerWeaLl ++++a ++ +++ ++ +++e + ++ ++ +l+eL +r+++L+ mKIAA1251 1742 KQDIARQK-SSLEATHDMVTRFMETADS-NSASVLQGKLAELSQRFQQLQ 1789 elaaeRkqkLee<-* + +e++ +L mKIAA1251 1790 LQQQEKESNLKK 1801 //