hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbp/mbp00320/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1243  ( 1080 res)   mbp00320

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SAP      Putative DNA-binding (bihelical) motif predi    43.2    3.4e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SAP        1/1     383   417 ..     1    35 []    43.2  3.4e-08

Alignments of top-scoring domains:
SAP: domain 1 of 1, from 383 to 417: score 43.2, E = 3.4e-08
                   *->lskLkVseLkdeLkkrGLstsGrKaeLvkRLleal<-*
                      l  LkVseLk eLk rGL++sG+K +L++RL+ +    
   mKIAA1243   383    LDDLKVSELKTELKLRGLPVSGTKPDLIERLKPYQ    417  

//