hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg06326/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1222 ( 395 res) mbg06326 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SAM_2 SAM domain (Sterile alpha motif) 74.5 2.2e-18 1 SAM_1 SAM domain (Sterile alpha motif) 58.7 1.2e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SAM_1 1/1 287 350 .. 1 66 [] 58.7 1.2e-13 SAM_2 1/1 286 352 .. 1 72 [] 74.5 2.2e-18 Alignments of top-scoring domains: SAM_1: domain 1 of 1, from 287 to 350: score 58.7, E = 1.2e-13 *->dgwsvesVgeWLesigllgqYidnFlaagyidgdtllqlteeDLedl ++wsv++V+ WL s+ l qY+ +F +a+ i+g++llql+ + L++l mKIAA1222 287 HEWSVQQVSHWLMSLSL-DQYVPEF-SAQSISGEQLLQLDGNKLKAL 331 GvtllGHrkkIlssIqgLk<-* G+t+ +r + ++ +k mKIAA1222 332 GMTSSQDRALVKKKLKEMK 350 SAM_2: domain 1 of 1, from 286 to 352: score 74.5, E = 2.2e-18 *->veswslesvaeWLesiglegqYkdnFsdqgitglellllrlteedLa v+ ws+++v++WL s+ l qY++ Fs+q i+g e+l l+l+ ++L mKIAA1222 286 VHEWSVQQVSHWLMSLSL-DQYVPEFSAQSISG-EQL-LQLDGNKL- 328 klalGitsvghRkkilskiqelkqq<-* k alG+ts ++R + +k++e+k + mKIAA1222 329 K-ALGMTSSQDRALVKKKLKEMKMS 352 //