hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg11133/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1208 ( 1237 res) mbg11133 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DMAP_binding DMAP1-binding Domain 148.9 8.8e-41 1 Notch Notch (DSL) domain 33.7 4.1e-06 2 efhand EF hand 18.8 0.13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Notch 1/2 435 471 .. 1 42 [] 28.3 8e-05 Notch 2/2 502 538 .. 1 42 [] 13.4 0.0056 DMAP_binding 1/1 701 813 .. 1 116 [] 148.9 8.8e-41 efhand 1/1 990 1018 .. 1 29 [] 18.8 0.13 Alignments of top-scoring domains: Notch: domain 1 of 2, from 435 to 471: score 28.3, E = 8e-05 *->sevsrdlCeakykrkC.aerfaNGvCNqeCNnaaCgfDGgDCs<-* +v + C ++C+ + ++G C+ +CNn aC +DGgDCs mKIAA1208 435 WPVPN--CA----EGCpGSWIKDGYCDKACNNSACDWDGGDCS 471 Notch: domain 2 of 2, from 502 to 538: score 13.4, E = 0.0056 *->sevsrdlCeakykrkCaer.faNGvCNqeCNnaaCgfDGgDCs<-* + s C+ ++Ca+ a++ C+q+CN CgfD gDC mKIAA1208 502 NTISY--CN----QGCANSwLADKFCDQACNVLSCGFDAGDCG 538 DMAP_binding: domain 1 of 1, from 701 to 813: score 148.9, E = 8.8e-41 *->eaasLPaeVreRLaeLdldLsegdiTeKGyeKkKlkLLaeFLpadqr ++++LP+e++ RL++Ldl+L++gdiT KGy+++K++LL++FL ++ + mKIAA1208 701 NISLLPKEAQVRLSNLDLQLERGDITLKGYNLSKSALLRSFLGNSLD 747 tkiklqaprtdetkknlevpqnqlsnlesklkseelseevylekVkalLa tkik+qa rtdetk+nlevpq+++s+++ +++++++++ ++++ +a ++ mKIAA1208 748 TKIKPQA-RTDETKGNLEVPQENPSHRR--PHGFAGEHRSERWTAPAETV 794 kelerengkpmpskersgl<-* ++++r+++ ++p+++++++ mKIAA1208 795 TVKGRDHALNPPPVLETNA 813 efhand: domain 1 of 1, from 990 to 1018: score 18.8, E = 0.13 *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-* + ++F e+D+D++G +s E +++ +++ mKIAA1208 990 NISQVFHEVDTDQSGVLSDREIRTLATRI 1018 //