hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg08216/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1197 ( 597 res) mbg08216 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- YEATS YEATS family 140.4 3.3e-38 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- YEATS 1/1 279 363 .. 1 87 [] 140.4 3.3e-38 Alignments of top-scoring domains: YEATS: domain 1 of 1, from 279 to 363: score 140.4, E = 3.3e-38 *->tHkWtvyvrglddedkEdlskfVkKVtFkLHpSFpnplRvvt.epPF tHkW+vyvrg ++e +++fVkKV+F LHpS+++++ v ++epPF mKIAA1197 279 THKWMVYVRGSRREP--SINHFVKKVWFFLHPSYKPNDLVEVrEPPF 323 eitEtGWGEFeieIkiffrndsnekkvsisHdLvldqegya<-* ++t++GWGEF+++++++f+ ds++k+++i+H+L++d++ + mKIAA1197 324 HLTRRGWGEFPVRVQVHFK-DSQNKRIDIIHNLKVDRTYTG 363 //