hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/msk/msk07057/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1177 ( 366 res) msk07057 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HAT HAT (Half-A-TPR) repeats 77.5 1.6e-18 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HAT 1/4 9 41 .. 1 34 [] 12.3 27 HAT 2/4 43 77 .. 1 34 [] 15.1 9.9 HAT 3/4 82 116 .. 1 34 [] 32.3 6.5e-05 HAT 4/4 190 224 .. 1 34 [] 19.5 0.49 Alignments of top-scoring domains: HAT: domain 1 of 4, from 9 to 41: score 12.3, E = 27 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* g ++ ++y+r l+ +++ + Ya+f+e+ mKIAA1177 9 GTFQSTKAVYDRILDLRI-ATPQIVINYAMFLEE 41 HAT: domain 2 of 4, from 43 to 77: score 15.1, E = 9.9 *->gdieraRkiyeralekfp.dksvdlWlkYaefEer<-* +++e+ k yer++ f ++ d+W Y+ ++ mKIAA1177 43 KYFEESFKAYERGISLFKwPNVSDIWSTYLTKFIS 77 HAT: domain 3 of 4, from 82 to 116: score 32.3, E = 6.5e-05 *->gdieraRkiyeralekfp.dksvdlWlkYaefEer<-* ++ eraR+++e+al+ +p+ + + l+l Ya++Ee+ mKIAA1177 82 RKLERARDLFEQALDGCPpKYAKTLYLLYAQLEEE 116 HAT: domain 4 of 4, from 190 to 224: score 19.5, E = 0.49 *->gdieraRkiyeralekfp.dksvdlWlkYaefEer<-* g+i+raR+iy + + + + +W+ + +fE r mKIAA1177 190 GEIDRARAIYSFCSQICDpRTTGAFWQTWKDFEVR 224 //