hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mic/mic27021/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1150 ( 369 res) mic27021 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- GATA GATA zinc finger 37.1 4e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- GATA 1/1 196 230 .. 1 36 [] 37.1 4e-07 Alignments of top-scoring domains: GATA: domain 1 of 1, from 196 to 230: score 37.1, E = 4e-07 *->CsnCgttkTplWRrgpdGnrtLCNACGLyykkhgvk<-* C++C+t+ Tp+W +G++ LC C+ k+ +k mKIAA1150 196 CAQCRTDFTPHWKQEKNGKI-LCEQCMTSNQKKALK 230 //