hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg10449/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1146 ( 342 res) mbg10449 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Ank Ankyrin repeat 82.1 1.1e-20 5 SOCS_box SOCS box 64.9 1.7e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Ank 1/5 43 78 .. 1 33 [] 7.5 17 Ank 2/5 84 116 .. 1 33 [] 23.6 0.0047 Ank 3/5 117 149 .. 1 33 [] 26.8 0.00049 Ank 4/5 150 182 .. 1 33 [] 18.1 0.2 Ank 5/5 198 230 .. 1 33 [] 10.4 6.3 SOCS_box 1/1 303 342 .] 1 42 [] 64.9 1.7e-15 Alignments of top-scoring domains: Ank: domain 1 of 5, from 43 to 78: score 7.5, E = 17 *->dGfTPLHlAalrgnlevvklLls...qGAdlnaqdd<-* + +T LH Aa+ g+l+ ++ Ll+++++ +n + mKIAA1146 43 CDDTRLHDAAYVGDLQTLRNLLQeesYRSRINEKSV 78 Ank: domain 2 of 5, from 84 to 116: score 23.6, E = 0.0047 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +TPL +Aa g+ ++v +L+ +GA+++++d mKIAA1146 84 LPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDV 116 Ank: domain 3 of 5, from 117 to 149: score 26.8, E = 0.00049 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G+T+L +A+ +g+le + Ll++GAd+n mKIAA1146 117 KGQTALYVAVVNGHLESTEILLEAGADPNGSRH 149 Ank: domain 4 of 5, from 150 to 182: score 18.1, E = 0.2 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* + TP +A++ g+ +++k L+ +GAd+++ mKIAA1146 150 HRSTPVYHASRVGRDDILKALIRYGADVDVNHH 182 Ank: domain 5 of 5, from 198 to 230: score 10.4, E = 6.3 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* PL + a + nl++ +lLl++GA+++ + mKIAA1146 198 LVVCPLYISAAYHNLQCFRLLLQAGANPDFNCN 230 SOCS_box: domain 1 of 1, from 303 to 342: score 64.9, E = 1.7e-15 *->prSLqhLCRlaIRrslgrdrlhlaikqLPLPprLkdYLleye<-* pr+L +LCR+a+Rr+lg++rlhl ++ LPLP ++k++Ll ye mKIAA1146 303 PRTLLSLCRVAVRRALGKYRLHL-VPSLPLPDPIKKFLL-YE 342 //