hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg09290/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1119 ( 791 res) mbg09290 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DIL DIL domain 192.6 6.4e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DIL 1/1 623 728 .. 1 113 [] 192.6 6.4e-54 Alignments of top-scoring domains: DIL: domain 1 of 1, from 623 to 728: score 192.6, E = 6.4e-54 *->qlfsQlFsfinaqlfNsLllrrdaacCswsrGmqirynlsqLeeWcr q+f+QlF++ina+++N+Lllr+d Csws+Gmq+ryn+sqLeeW+r mKIAA1119 623 QVFKQLFYMINAVTLNNLLLRKD--ACSWSTGMQLRYNISQLEEWLR 667 eagledagdLawdeLepLrQavqLLqvkkktkedisddeiicdlCpaLsp +++l+ +g a++++epL+Qa+qLLq kkkt ed+ e+ic+lC++Ls+ mKIAA1119 668 GKNLHQSG--AVQTMEPLIQAAQLLQLKKKTHEDA---EAICSLCTSLST 712 aQlvkiLtlYqpddye<-* +Q+vkiL+lY+p +++ mKIAA1119 713 QQIVKILNLYTPLNEF 728 //