hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbj/mbj00492/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1068 ( 107 res) mbj00492 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Nuclear_move Nuclear movement protein 31.7 4e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Nuclear_move 1/1 1 79 [. 1 160 [] 31.7 4e-07 Alignments of top-scoring domains: Nuclear_move: domain 1 of 1, from 1 to 79: score 31.7, E = 4e-07 *->nsgnGadlenYqWtQTLqEVevrvPvPkgtalKakdvvVdisksslk + G ++ev+ mKIAA1068 1 RHRSG-------------DAEVN------------------------ 10 VglkGqepeVivdGkLyhkikaeEStWtlEdtkrkgkrvvitLeKvNkME L+Kv+++ mKIAA1068 11 ------------------------------------------LSKVGEY- 17 WWnrllegePeIDtkkinPEnSKLsDLDeETRamVEKMMyDQrQKemGlP WW+++lege++ID++kin+E+S ++++DeE++a+++++++D++QK++G+P mKIAA1068 18 WWSAILEGEEPIDIDKINKERS-MATVDEEEQAVLDRLTFDYHQKLQGKP 66 tSdEqKkqdiLkK<-* +S+E+K++++LkK mKIAA1068 67 QSHELKVHEMLKK 79 //