hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mfj/mfj03252/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1065 ( 658 res) mfj03252 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ENTH Epsin N-terminal homology (ENTH) domain 233.4 1.9e-65 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ENTH 1/1 36 162 .. 1 137 [] 233.4 1.9e-65 Alignments of top-scoring domains: ENTH: domain 1 of 1, from 36 to 162: score 233.4, E = 1.9e-65 *->sdlevkVrkATnndewgpkgkhlreIlqgTsneklrssfaeimavlw s++e+kVr+AT+nd+wgp+++++ eI+++T+n+ ++f eim+++w mKIAA1065 36 SEAEIKVREATSNDPWGPSSSLMTEIADLTYNV---VAFSEIMSMVW 79 rRLndkgknWrvvyKaLillhyLlrnGspfervvlealrnrnrIltLsdf +RLnd+gknWr+vyKaL+ll+yL++ Gs erv +++++n+ I+tL+df mKIAA1065 80 KRLNDHGKNWRHVYKALTLLDYLIKTGS--ERVAQQCRENIFAIQTLKDF 127 qdkvfndidsrgkDqGaniRtyakyLlelledderlkeer<-* q+ id++gkDqG+n+R+++k+L++ll+d+erlk er mKIAA1065 128 QY-----IDRDGKDQGINVREKSKQLVALLKDEERLKVER 162 //