hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj05092/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1063 ( 570 res) mfj05092 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UCH Ubiquitin carboxyl-terminal hydrolase 284.8 1.1e-81 1 zf-UBP Zn-finger in ubiquitin-hydrolases and other 22.7 0.0024 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- zf-UBP 1/1 108 177 .. 1 82 [] 22.7 0.0024 UCH 1/1 218 562 .. 1 273 [] 284.8 1.1e-81 Alignments of top-scoring domains: zf-UBP: domain 1 of 1, from 108 to 177: score 22.7, E = 0.0024 *->CvstCgl.tenlWlCLtCGqvgCGryqylgdGgngHaleHyretgHp C +Cg++ ++l CL+C + gC + +H +H + +H mKIAA1063 108 C-HVCGIhLNRLHSCLYCVFFGCFTK--------KHIHDHAKSKRHN 145 lavklktqstwcyacdaYvhqeddeedalDgkylvd<-* la++l + +c+ c++Y+++ d e + + ++ mKIAA1063 146 LAIDLMYGGIYCFLCQDYIYDKDIEI--IAKE--EQ 177 UCH: domain 1 of 1, from 218 to 562: score 284.8, E = 1.1e-81 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx *->pgptGLvNlGNTCYmNSvLQcLfhipplrdyllsdsyeseinesnpl g++GL+NlGNTC+mN+++Q+L+h+p lrd++lsd+++ + + mKIAA1063 218 IGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHR-----CEMQ 259 RF xxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxxxxx gskgsllcaladLfnalqsg.yksvvpsplkflqfkttlgkineefsgym +++ +l+c+++ Lf++++sg++++ p++l++ +++ ++ ++gy mKIAA1063 260 SPSSCLVCEMSSLFQEFYSGhRSPHIPYKLLH-----LVWTHARHLAGYE 304 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx QqDAhEFllfLLdgLhedlnrvnkkpytepesdkrpdkaaeawknhslrn QqDAhEFl + Ld Lh+ +++ ++++ + + + mKIAA1063 305 QQDAHEFLIAALDVLHRHCKGDDNGKKANNP----------------NHC 338 RF xxxxxxxxxxxxxx eslitdlFqGqles.................................... ++i+++F+G l s+ +++ +++ +++ ++ + + + ++++++ + ++ mKIAA1063 339 NCIIDQIFTGGLQSdvtcqvchgvsttidpfwdisldlpgsstpfwplsp 388 RF .................................................. +++++ +++++ +++++ +++ ++ +++++ +++ + +++++++ ++++ mKIAA1063 389 gsegsvvngeshasgtttltdclrrftrpehlgssakikcsgchsyqest 438 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx .rlkisrLPpiLiihLKRFkydgetgmnkKindkVefPleLdlssyctae ++l++++LP + ++hLKRF+ + +++Ki + V+fPleLd++++++++ mKIAA1063 439 kQLTMKKLPIVACFHLKRFEHSAK--LRRKITTYVSFPLELDMTPFMASS 486 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx .................pplkYeLyaVvvHsGsslsgGHYiayikkkkkn +++ +++ +++ ++ +++ kY+L+aVv+H G +l++GHY+++i + ++ mKIAA1063 487 kesrmngqyqqpldslnNDNKYSLFAVVNHQG-TLESGHYTSFI--RQHK 533 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx nkWykfDDekVsevseeevlersssAYiLFY<-* ++W+k+DD ++ +s +v s++Y+LFY mKIAA1063 534 DQWFKCDDAIITKASIKDV--LDSEGYLLFY 562 //