>>>mKIAA1062 ( 1416 res) mbg17754 >ATP_GTP_A2 9.026 907 pos. 1 - 26 PS50101|ATP_GTP_A2 P-loop nucleotide binding motif (does not find all). VVSFLGHNGAGKTTTMSILTGLFPPT >DA_BOX_1 18.561 1007 pos. 105 - 175 PS50100|DA_BOX 2nd half motif for nucleotide binding, associated with P-loop. LSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTILLSTHHMD EADLLGDRIAI >DA_BOX_2 17.892 970 pos. 1169 - 1240 PS50100|DA_BOX 2nd half motif for nucleotide binding, associated with P-loop. YSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRSVVLTSHSM EECEALCTRLAI