hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbp/mbp04321/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1051 ( 549 res) mbp04321 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Retrotrans_gag Retrotransposon gag protein 93.5 4.3e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Retrotrans_gag 1/1 264 357 .. 1 100 [] 93.5 4.3e-24 Alignments of top-scoring domains: Retrotrans_gag: domain 1 of 1, from 264 to 357: score 93.5, E = 4.3e-24 *->klavtfLeGrAltWwkslvarsidaidsWdelkdaFlkrFvpsavkd +++++ L GrA+ W+++ ++r+++ ++++ +++++++ +F+++++++ mKIAA1051 264 CFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVFEDPQRRE 310 qleseLrqlrQkgtesvreYverFkrlarqapheggvrteealisaFlrG ++++++r+lrQ g ++v +Y F+ +a++++ +te+al++ F +G mKIAA1051 311 AAKRKIRRLRQ-GPGPVVDYSNAFQMIAQDLD-----WTEPALMDQFQEG 354 Lre<-* L++ mKIAA1051 355 LNP 357 //