hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm07344/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1041 ( 595 res) mpm07344 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Fork_head Fork head domain 191.7 1.1e-53 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Fork_head 1/1 84 179 .. 1 101 [] 191.7 1.1e-53 Alignments of top-scoring domains: Fork_head: domain 1 of 1, from 84 to 179: score 191.7, E = 1.1e-53 *->KPPYSYiaLItmAIqqySpekrLtLseIYkfImdrFPYYRqnkqgWQ KPPYSY++LIt AI + Sp k++tLseIY++I d+FPYYR++ +gW+ mKIAA1041 84 KPPYSYASLITFAINS-SPKKKMTLSEIYQWICDNFPYYREAGSGWK 129 NSIRHNLSLNkcFiKVpRspdkpGKGsyWtldPeaedmFenkkkkgsflk NSIRHNLSLNkcF KVpRs+d+pGKGsyW++d + +++ + k mKIAA1041 130 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTLP----TRPKK 175 rrrr<-* r r mKIAA1041 176 RARS 179 //