hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpg/mpg00453/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1031 ( 698 res) mpg00453 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TPR Tetratricopeptide repeats 38.4 9.5e-07 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TPR 1/2 121 154 .. 1 34 [] 26.8 0.0031 TPR 2/2 155 188 .. 1 34 [] 12.3 20 Alignments of top-scoring domains: TPR: domain 1 of 2, from 121 to 154: score 26.8, E = 0.0031 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* + + n++ +y+ +g y++A+e+ ekAL ld + mKIAA1031 121 CKLHVNRAACYFTMGLYEKALEDSEKALGLDGES 154 TPR: domain 2 of 2, from 155 to 188: score 12.3, E = 20 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* ++al++++ a+ lg+++eA e+ +++ P++ mKIAA1031 155 IRALFRKARALNELGRHKEAYECSSRCSLALPHD 188 //