hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpg/mpg00833/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1013 ( 989 res) mpg00833 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- B41 Band 4.1 homologues 131.0 1.3e-34 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- B41 1/1 9 214 .. 1 232 [] 131.0 1.3e-34 Alignments of top-scoring domains: B41: domain 1 of 1, from 9 to 214: score 131.0, E = 1.3e-34 *->spkprvlkVylldgttlefevdssttaeelletvcrklglspresey + r++ V+lld+ le+ v+++ +ell+ v+ +++l +e+ey mKIAA1013 9 MTEGRHCQVHLLDDRRLELLVQPKLLSRELLDLVASHFNL--KEKEY 53 FgLqfedkdedshWldpaktilkqdvkspksepltlyFRvkFyppdwhgp Fg+ f+d++++ Wl+++ +l++d k++p l+F v+Fy++ mKIAA1013 54 FGITFIDDTGQENWLQLDHRVLEHDLP-KKPGPTLLHFAVRFYIES---- 98 peqlkeDptrynllylQvrddilsGrlpcpseeeallLAaLalqaefGdy + lk+ +t++ l++l ++ + +G + + e+ + LAaL lq Gdy mKIAA1013 99 ISFLKDKNTVE-LFFLNAKACVHKGQIEVD-SETIFKLAALVLQESKGDY 146 dpeeeekkkslkhvakelslkrflPkqlldsikasflqiqltlkewrerI + + +k+l +P ++l+++ l + ++r+ mKIAA1013 147 TSD--------ENARKDLKTLPVFPTKTLQEHPS--------LAYCEDRV 180 velhkehaglspeeaklkYLelarrLpptYGvelF<-* e + +++gl++ +a ++Y+++++ Lp tYGv+++ mKIAA1013 181 IEHYLKIKGLTRGQAVVQYMKIVEALP-TYGVHYY 214 //