hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbh/mbh02928/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA1002 ( 1070 res) mbh02928 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- R3H Putative single-stranded nucleic acids-bindi 70.5 2.2e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- R3H 1/1 178 255 .. 1 83 [] 70.5 2.2e-16 Alignments of top-scoring domains: R3H: domain 1 of 1, from 178 to 255: score 70.5, E = 2.2e-16 *->adflpllldiesyrprrreelielaleiakffvkstkesvelpPsMn +d++ +l+++++ +pr+r++l++l++ei++f+ +++++ +++p M+ mKIAA1002 178 IDLHEFLVNTLKKNPRDRMMLLKLEQEILDFINDNNNQFKKFPQ-MT 223 syeRkivHelaekygLeSeSeGegpkeNRrvvvskk<-* sy+R++ H++a ++g+ +++ + g + v++ k+ mKIAA1002 224 SYHRMLLHRVAAYFGMDHNVDQTG----KAVIINKT 255 //