hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh02928/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA1002  ( 1070 res)   mbh02928

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
R3H      R3H domain                                      65.6      1e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
R3H        1/1     202   255 ..     1    58 []    65.6    1e-15

Alignments of top-scoring domains:
R3H: domain 1 of 1, from 202 to 255: score 65.6, E = 1e-15
                   *->eeeiadfvrvkstgksvflpPMtsyeRkliHqlaeefgdLeseSeGe
                      e+ei+df + +++++ +++p+Mtsy+R+l+H++a++fg + ++++++
   mKIAA1002   202    EQEILDF-INDNNNQFKKFPQMTSYHRMLLHRVAAYFG-MDHNVDQT 246  

                   gpkRrvviskk<-*
                   g  + v+i+k+   
   mKIAA1002   247 G--KAVIINKT    255  

//