hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh01028/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0887 ( 429 res) mbh01028 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UBX UBX domain 15.0 0.041 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UBX 1/1 340 425 .. 1 90 [] 15.0 0.041 Alignments of top-scoring domains: UBX: domain 1 of 1, from 340 to 425: score 15.0, E = 0.041 *->ekaedvcrlqiRlPDGsRlvrrFnssdtlqdvydfvdshrygadepe +++ +++ ++lP+ sR +rrF s +l + df+ s + ++ mKIAA0887 340 PDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEK-- 384 dYkheFeFsLltpfPrrlltkldesk.....tLkeagllpnstlvlep<- F++ +fPrr+l + + ++++tL+eagl ++l+++ mKIAA0887 385 -------FQIEANFPRRVLPCVPSEEwpnppTLQEAGLSHTEVLFVQD 425 * mKIAA0887 - - //