hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/TIGRFAMs_HMM.LIB Sequence file: /cdna4/rodent/full/goal/mbg/mbg00520/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0875 ( 625 res) mbg00520 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- yccV yccV: hemimethylated DNA binding domain 194.3 1.9e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- yccV 1/1 498 595 .. 1 103 [] 194.3 1.9e-54 Alignments of top-scoring domains: yccV: domain 1 of 1, from 498 to 595: score 194.3, E = 1.9e-54 *->aakFriGqvvRHklfgyrGVVidvDPeyanteewleaipveirprGk +++++iG+v++Hk++gy++V++++DP++++++ew+++++v+++p+G+ mKIAA0875 498 DVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGH 544 dQPFYhVLvEddegeplyvaYvaEeNLlsdesdepiehPqvdelFdkfde +QPFY+VLvEd++++ Y+a+eNL++++++++i+hP+v+++F++f++ mKIAA0875 545 HQPFYNVLVEDGSCR-----YAAQENLEYNVEPQEISHPDVGRYFSEFTG 589 glykpk<-* ++y+p+ mKIAA0875 590 THYIPN 595 //