hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg06229/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0820 ( 452 res) mbg06229 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- GED Dynamin GTPase effector domain 124.5 1.2e-32 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- GED 1/1 237 328 .. 1 97 [] 124.5 1.2e-32 Alignments of top-scoring domains: GED: domain 1 of 1, from 237 to 328: score 124.5, E = 1.2e-32 *->qedseleeIksllkSYfnivrktladqvPkaImhllvneskdslqnF q ++++e+I++l++SY++i+ k ++d +Pk Imhl++n+ kd++++ mKIAA0820 237 QLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINS- 282 QellakLykpraeelldeLLeEdpeiaskRkelkkrLelLkkArqiisev ella+Ly +e+++ L+eE+ e a++R e+ +++ +Lk+A ii ++ mKIAA0820 283 -ELLAQLYS---SEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDI 328 <-* mKIAA0820 - - //