hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph02383/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0794 ( 367 res) mph02383 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UBX UBX domain 111.5 1.7e-29 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UBX 1/1 285 365 .. 1 90 [] 111.5 1.7e-29 Alignments of top-scoring domains: UBX: domain 1 of 1, from 285 to 365: score 111.5, E = 1.7e-29 *->ekaedvcrlqiRlPDGsRlvrrFnssdtlqdvydfvdshrygadepe ++++++++l++R+PDG+R++++ + +++l +++++v+s++y+++ mKIAA0794 285 DVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNER-- 329 dYkheFeFsLltpfPrrlltkldesktLkeagllpnstlvlep<-* F+Llt+fPrr l++ld++ tL+eagl+p++t+++++ mKIAA0794 330 -------FELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQE 365 //