hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg09833/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0777 ( 1134 res) mbg09833 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SH3 Src homology 3 domains 224.7 8.1e-63 3 Sorb Sorbin homologous domain 126.6 2.7e-33 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Sorb 1/1 6 56 .. 1 55 [] 126.6 2.7e-33 SH3 1/3 900 955 .. 1 58 [] 91.7 8.6e-23 SH3 2/3 975 1032 .. 1 58 [] 78.8 6.5e-19 SH3 3/3 1078 1134 .] 1 58 [] 56.2 4.3e-12 Alignments of top-scoring domains: Sorb: domain 1 of 1, from 6 to 56: score 126.6, E = 2.7e-33 *->vrnvdypgivpvDEsGIPlasPrSsveRpkDmSQWYrtMFKQIHrkg +++++ypgi+pvDEsGIP+a+ r++v+RpkD WY+tMFKQIH+++ mKIAA0777 6 IKAPHYPGIGPVDESGIPTAI-RTTVDRPKD---WYKTMFKQIHMVH 48 kpDddnDv<-* kpD+d+D+ mKIAA0777 49 KPDEDTDM 56 SH3: domain 1 of 3, from 900 to 955: score 91.7, E = 8.6e-23 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG ++A+YD++aq++ ELsFkkGD++++l+k+d++W+eGe++ G++G mKIAA0777 900 LPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHH--GRVG 944 lfPsnYVeeie<-* +fP +YVe+++ mKIAA0777 945 IFPISYVEKLT 955 SH3: domain 2 of 3, from 975 to 1032: score 78.8, E = 6.5e-19 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG ++++A+Y+++a++ ELs++kGD i++l+++d++W+eG++ +t+++G mKIAA0777 975 GEAIAKYNFNADTNVELSLRKGDRIILLKRVDQNWYEGKIPGTNRQG 1021 lfPsnYVeeie<-* +fP +YVe+++ mKIAA0777 1022 IFPVSYVEVVK 1032 SH3: domain 3 of 3, from 1078 to 1134: score 56.2, E = 4.3e-12 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG e ++AlY+y+++nedEL +++ D++ v ek+ddgW+ G+ +rt G mKIAA0777 1078 EPFQALYNYTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFG 1124 lfPsnYVeeie<-* fP+nYV + mKIAA0777 1125 TFPGNYV-KRL 1134 //