hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mfj/mfj22320/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0771 ( 1105 res) mfj22320 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SH3 Src homology 3 domains 76.6 3.1e-18 1 ANK ankyrin repeats 70.6 2e-16 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/2 935 964 .. 1 30 [] 38.8 7.1e-07 ANK 2/2 968 997 .. 1 30 [] 32.0 8.2e-05 SH3 1/1 1037 1095 .. 1 58 [] 76.6 3.1e-18 Alignments of top-scoring domains: ANK: domain 1 of 2, from 935 to 964: score 38.8, E = 7.1e-07 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G TpLH A++ g++++vk+Lld g+++na mKIAA0771 935 EGITPLHNAVCAGHHHIVKFLLDFGVNVNA 964 ANK: domain 2 of 2, from 968 to 997: score 32.0, E = 8.2e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* dG+TpLH+Aa+ ++++++k L+++ga i a mKIAA0771 968 DGWTPLHCAASCNSVHLCKQLVESGAAIFA 997 SH3: domain 1 of 1, from 1037 to 1095: score 76.6, E = 3.1e-18 *->eyvvAlYDyeaqnedELsFkkGDiitvleks...ddgWweGelnrtG ++v Al+Dyeaqn+dELsF++GD it+l++ ++++ +Ww+++l+ mKIAA0771 1037 GTVYALWDYEAQNSDELSFHEGDAITILRRKdenETEWWWARLG--D 1081 keGlfPsnYVeeie<-* +eG++P+n + +++ mKIAA0771 1082 REGYVPKNLLGLYP 1095 //